# hmmsearch :: search profile(s) against a sequence database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: Terpene_synth_C.hmm # target sequence database: Physcomitrella-patens.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Terpene_synth_C [M=267] Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-79 268.7 2.3 1.6e-79 268.0 1.6 1.3 1 XP_001770788.1 predicted protein [Physcomitrella patens] 1.1e-16 62.0 0.1 1.2e-16 61.9 0.0 1.0 1 XP_001751333.1 predicted protein, partial [Physcomitrella pa ------ inclusion threshold ------ 0.53 10.6 0.1 0.8 10.0 0.0 1.1 1 XP_001763290.1 predicted protein [Physcomitrella patens] Domain annotation for each sequence (and alignments): >> XP_001770788.1 predicted protein [Physcomitrella patens] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 268.0 1.6 1.4e-83 1.6e-79 1 266 [. 431 694 .. 431 695 .. 0.96 Alignments for each domain: == domain 1 score: 268.0 bits; conditional E-value: 1.4e-83 Terpene_synth_C 1 LeLAkldFnllqslhqkElkelsrWwkelglaskLsfaRdrlvecyfwalgvifepeysraRiilaKvivlitilDDtyDvygtleElekltea 94 L+LAk dFn++q+lh+kEl+++ +W +++ +L+faR++ vecyf+ ++++fepe+ +aR+++a+++vl+t+lDD++D+ +eEl+ +++a XP_001770788.1 431 LKLAKADFNMCQALHKKELEQVIKWNASCQF-RDLEFARQKSVECYFAGAATMFEPEMVQARLVWARCCVLTTVLDDYFDHGTPVEELRVFVQA 523 89*****************************.************************************************************** PP Terpene_synth_C 95 ierWdesaveelpeylkilykallntfneledelekeeksdrvskylkeawkelvkaylkeakWreekyvPsfeEylevsvvssglpllllaal 188 ++ W+ + ++ lpe+ kil+ l++t+n +++e+ +k +v+++lk+ w +l+ + lkea+W+e++yvP+f+Ey+ev+ +s++l+++++++l XP_001770788.1 524 VRTWNPELINGLPEQAKILFMGLYKTVNTIAEEAFMAQKR-DVHHHLKHYWDKLITSALKEAEWAESGYVPTFDEYMEVAEISVALEPIVCSTL 616 ************************************6777.7***************************************************9 PP Terpene_synth_C 189 vgmgdevtkeafewvasypklvkasstilRllnDiasyereqkrgdvassvecymkehg.v.seeeAieeikkliedawk 266 ++ g+ ++++++++ +y+ ++++++ ++R+lnDi++++re ++g++ ssv++ym+eh+ v se Ai+++++l++++++ XP_001770788.1 617 FFAGHRLDEDVLDS-YDYHLVMHLVNRVGRILNDIQGMKREASQGKI-SSVQIYMEEHPsVpSEAMAIAHLQELVDNSMQ 694 9***9899987766.46899************************555.***********879999**********99875 PP >> XP_001751333.1 predicted protein, partial [Physcomitrella patens] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.9 0.0 9.9e-21 1.2e-16 45 103 .. 1 59 [. 1 63 [. 0.96 Alignments for each domain: == domain 1 score: 61.9 bits; conditional E-value: 9.9e-21 Terpene_synth_C 45 cyfwalgvifepeysraRiilaKvivlitilDDtyDvygtleEleklteaierWdesav 103 cyf+ ++++fepe+ ++R+++a+++vl+t+lDD++Dv ++eEl+ +++a++ W+ + + XP_001751333.1 1 CYFAGAAIMFEPEMVQTRLVWARCCVLTTVLDDYFDVGTSVEELRVFVQAVRTWNPKLI 59 9*****************************************************98765 PP >> XP_001763290.1 predicted protein [Physcomitrella patens] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.0 0.0 6.6e-05 0.8 25 55 .. 158 188 .. 148 194 .. 0.86 Alignments for each domain: == domain 1 score: 10.0 bits; conditional E-value: 6.6e-05 Terpene_synth_C 25 WwkelglaskLsfaRdrlvecyfwalgvife 55 Ww e + +++L ++R rlve+ +++vi + XP_001763290.1 158 WWWEQHKQKRLRYTRGRLVELMWSTNIVISD 188 88888888*************9999888865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (267 nodes) Target sequences: 35934 (13047009 residues) Passed MSV filter: 919 (0.0255747); expected 718.7 (0.02) Passed bias filter: 569 (0.0158346); expected 718.7 (0.02) Passed Vit filter: 52 (0.0014471); expected 35.9 (0.001) Passed Fwd filter: 3 (8.34864e-05); expected 0.4 (1e-05) Initial search space (Z): 35934 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.61u 0.00s 00:00:00.61 Elapsed: 00:00:00.13 # Mc/sec: 26796.55 //